PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10012391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 192aa    MW: 21820.6 Da    PI: 10.0654
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10012391genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.13e-1161110554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  kr +r   NR++A rs +RK  +i eLe+kv++L+ae ++L  ++  l++
  Lus10012391  61 KRVKRILANRLSAARSKERKMRYISELEQKVQTLQAEATTLSAQVTVLQN 110
                  899**************************************999887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-1457121IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.18559116IPR004827Basic-leucine zipper domain
PfamPF001708.6E-1061112IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-1161111No hitNo description
Gene3DG3DSA:1.20.5.1703.4E-1261116No hitNo description
CDDcd147031.37E-1662109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MEREEEKERG NRIGQLSPSG SMQGSLTKFN LEFVNGEFTE AELKKIMSND KLTELAMADP  60
KRVKRILANR LSAARSKERK MRYISELEQK VQTLQAEATT LSAQVTVLQN HELKFRLQAM  120
EQQAQLKDAL NEALVGEVQR LRLAATDVGA DTSHHHHQQQ QQLLGNIMQQ QNAYQHQRQR  180
STQLNQAQSS K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073848.12e-66PREDICTED: transcription factor VIP1-like
RefseqXP_012441810.16e-66PREDICTED: uncharacterized protein LOC105766783
RefseqXP_012441813.16e-66PREDICTED: uncharacterized protein LOC105766783
SwissprotQ9MA752e-40VIP1_ARATH; Transcription factor VIP1
TrEMBLA0A067KLE42e-66A0A067KLE4_JATCU; Uncharacterized protein
TrEMBLA0A0D2PWA07e-66A0A0D2PWA0_G
STRINGVIT_03s0038g00860.t011e-62(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.35e-61bZIP family protein